Home > Product > Catalog Peptides > Others > Diapause-specific peptide

Others

Diapause-specific peptide

[Price Inquiry]
CAT#
P36010
Sequence
AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN
Modifications
Disulfide bond(3)
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.