Home > Product > Antimicrobial Peptides > Diapausin precursor

Antimicrobial Peptides

Diapausin precursor

Price Inquiry
CAT#
AF2746
Sequence
RVGPCDQVCSRIDAEKDECCRAHGYSGYNSCRGGRMDC
Host Chemicals
Spodoptera exigua
Length
38
Activity
Antimicrobial
SwissProt ID
E1B227

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.