Home > Product > Antimicrobial Peptides > Diapausin precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Diapausin precursor

[Price Inquiry]
CAT#
AF2746
Sequence
RVGPCDQVCSRIDAEKDECCRAHGYSGYNSCRGGRMDC
Host Chemicals
Spodoptera exigua
Length
38
Activity
Antimicrobial
SwissProt ID
E1B227
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.