Home > Product > Antimicrobial Peptides > Diptericin

Antimicrobial Peptides

Diptericin

[Price Inquiry]
CAT#
AF2564
Sequence
DLHIPPPDNKINWPQLSGGGGGSPKTGYDININAQQK
Host Chemicals
Sarcophaga peregrina
Length
37
Activity
Antibacterial
SwissProt ID
Q9TWW2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.