Home > Product > Antimicrobial Peptides > Dm-AMP1

Antimicrobial Peptides

CAT#
AF3257
Sequence
ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC
Host Chemicals
seeds, Dahlia merckii
Length
50
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.