Home > Product > Antimicrobial Peptides > Dolabellanin-B2

Antimicrobial Peptides

Dolabellanin-B2

[Price Inquiry]
CAT#
AF2294
Sequence
SHQDCYEALHKCMASHSKPFSCSMKFHMCLQQQ
Host Chemicals
Dolabella auricularia
Length
33
Activity
Antibacterial, Antifungal
SwissProt ID
P83376
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.