Home > Product > Antimicrobial Peptides > Dolabellanin-B2

Antimicrobial Peptides

Dolabellanin-B2

Price Inquiry
CAT#
AF2294
Sequence
SHQDCYEALHKCMASHSKPFSCSMKFHMCLQQQ
Host Chemicals
Dolabella auricularia
Length
33
Activity
Antibacterial, Antifungal
SwissProt ID
P83376

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.