Home > Product > Antimicrobial Peptides > Drosomycin-2

Antimicrobial Peptides

Drosomycin-2

Price Inquiry
CAT#
AF3060
Sequence
DCLSGKYKGPCAVWDNEMCRRICKEEGHISGHCSPSLKCWCEGC
Host Chemicals
fruit fly, Drosophila melanogaster
Length
44
Activity
Fungi, Parasites,

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.