Home > Product > Antimicrobial Peptides > Drosomycin-2

Antimicrobial Peptides

Drosomycin-2

[Price Inquiry]
CAT#
AF3060
Sequence
DCLSGKYKGPCAVWDNEMCRRICKEEGHISGHCSPSLKCWCEGC
Host Chemicals
fruit fly, Drosophila melanogaster
Length
44
Activity
Fungi, Parasites,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.