Home > Product > Antimicrobial Peptides > Drosomycin

Antimicrobial Peptides

Drosomycin

[Price Inquiry]
CAT#
AF3061
Sequence
DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC
Host Chemicals
Drosophila melanogaster
Length
44
Activity
Antifungal
SwissProt ID
P41964
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.