Home > Product > Catalog Peptides > Others > Drosomycin

Others

warning All products are for research use only. Not for human use.

Drosomycin

[Price Inquiry]
CAT#
D10001
Sequence
DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC
Modifications
Disulfide bond(4)
Length
44
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.