Keywords Search Google Search Search

Duck AvBD9

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2920
Sequence	ADTLACRQSHQSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF549	Temporin-1CEb	Inquiry
AF2551	Cecropin-D	Inquiry
AF3230	NaD1	Inquiry
AF205	Temporin-PRb	Inquiry
AF033	Defensin precursor	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Atosiban Gives Preterm Labor A Maintenance Treatment

This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...

Basic information of Somatostatin

The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...

Function of trifluoroacetyl tripeptide-2 in human skin

An overview of trifluoroacetyl tripeptide-2 Peptides are chains of amino acids joined by peptide bond. Peptides are mostly i ...

Trimetazidine and related diseases

Trimetazidine is a partial fatty acid oxidation inhibitor that inhibits 3-ketoacyl CoA thiolase, one of the enzymes of fatty ...

Purotoxin 1, a highly selective blocker of Р2Х3 receptors

Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Anas platyrhynchos
Length	42