Home > Product > Antimicrobial Peptides > Duck AvBD9

Antimicrobial Peptides

Duck AvBD9

[Price Inquiry]
CAT#
AF2920
Sequence
ADTLACRQSHQSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS
Host Chemicals
Anas platyrhynchos
Length
42
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.