Home > Product > Catalog Peptides > Others > E7 (43.77), HPV Oncoprotein

Others

E7 (43.77), HPV Oncoprotein

[Price Inquiry]
CAT#
C08086
Sequence
GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR
M.W/Mr.
3980.6
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.