CAT# | C08086 |
M.W/Mr. | 3980.6 |
Sequence | GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR |
Length | 35 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
X01649 | PH1PO073_02 | Inquiry | ||
X10505 | PM_20123969 | Inquiry | ||
X03137 | PM_10693954 | Inquiry | ||
T12007 | Macrophage Inhibitory Peptide | Inquiry | ||
X08236 | PM_16629824 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...
Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...