Keywords Search Google Search Search

EC-proHep3

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF1991
Sequence	APAKCTPYCYPTRDGVFCGVRCDFQHHHHHH
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF1550	Lycocitin-3	Inquiry
AF3098	Coagulin	Inquiry
AF881	CGA 41-60	Inquiry
AF2747	Gallinacin-4	Inquiry
AF3206	Viscotoxin A1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of icatibant in hereditary angioedema

Icatibant, sold under the trade name Firazyr, is a plasma kallikrein inhibitor and the bradykinin B2 receptor an ...

Novel Peptide Drugs Treat Multiple Diseases (Part One)

Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...

Methamphetamine and Substance P

Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...

The Function of Deferasirox in Iron Overload

Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...

Function of PM102 for the reversal of heparin anticoagulation

PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Epinephelus coioides
Length	31