Home > Product > Antimicrobial Peptides > EC-proHep3

Antimicrobial Peptides

EC-proHep3

[Price Inquiry]
CAT#
AF1991
Sequence
APAKCTPYCYPTRDGVFCGVRCDFQHHHHHH
Host Chemicals
Epinephelus coioides
Length
31
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.