Home > Product > Catalog Peptides > Others > Ectatomin subunit A

Others

Ectatomin subunit A

[Price Inquiry]
CAT#
E11001
Sequence
GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL
Modifications
Disulfide bond
Length
37
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.