CAT# | E11001 |
Sequence | GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL |
Length | 37 | Modifications | Disulfide bond |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
X16933 | PM_9801820 | Inquiry | ||
R1078 | Hemopressin (rat) | Inquiry | ||
X21102 | WGTVS_skin | Inquiry | ||
X14044 | PM_7996462 | Inquiry | ||
X19780 | UP_P82358 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...
The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...