Home > Product > Catalog Peptides > Others > Ectatomin subunit B

Others

Ectatomin subunit B

[Price Inquiry]
CAT#
E11002
Sequence
WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK
Modifications
Disulfide bond
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.