Home > Product > Catalog Peptides > Others > Ectatomin subunit B

Others

Ectatomin subunit B

Price Inquiry
CAT#
E11002
Sequence
WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK
Modifications
Disulfide bond
Length
34

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.