Home > Product > Catalog Peptides > Others > EF-hand

Others

CAT#
S15015
Sequence
PMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKD
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.