Keywords Search Google Search Search

EF-hand 3

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	V10003
Sequence	SFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKM

CAT#	Product Name	Inquiry
X00303	GVLRG_multorg	Inquiry
X09836	PM_19100827	Inquiry
X04969	PM_12033493	Inquiry
X11785	PM_2898716	Inquiry
X11183	PM_2455720	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of myristoyl hexapeptide-4 for improvement of skin

Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...

Function of peginesatide in anemia

Peginesatide sold under the brand name Omontys, formerly Hematide, is a synthetic peptide consisting of two 21 a ...

The opiate delta receptor antagonist-ICI 154,129

ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...

Pentagastrin functions as diagnostic aids

Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...

Function of palmitoyl tripeptide-38 in skin

Palmitoyl Tripeptide-38, named MATRIXYL synthe'6 and Volulip, a cosmetic peptide or double-oxidized lipopeptide, ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: