Home > Product > Catalog Peptides > Others > EF-hand 4

Others

CAT#
V10004
Sequence
TPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSI
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.