Keywords Search Google Search Search

EF-hand 4

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	V10004
Sequence	TPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSI

CAT#	Product Name	Inquiry
X00492	PH1BS002_04	Inquiry
X04974	PM_12036373	Inquiry
X09197	PM_18037781	Inquiry
C08080	CTT, Gelatinase Inhibitor	Inquiry
T2703	Pz-Pro-Leu-Gly-Pro-D-Arg-OH	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

BA 1, a potent BRS-3 agonist

BA 1 (DTyr-Gln-Trp-Ala-Val- Ala-His-Phe-Nle-NH2) is a potent BRS-3 agonist (IC50 = 2.52 nM) and a NMBR and GRPR ...

Gap 19: Specifically block Cx43 hemichannels inhibitor

Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...

Function of ganirelix in infertility

Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...

An undecapeptite of mollusk origin-Eledoisin

Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...

Ziconotide: Use in the treatment of pain

Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: