Home > Product > Catalog Peptides > Others > Elafin

Others

CAT#
S15008
Sequence
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Modifications
Disulfide bond(4)
Length
57
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.