Home > Product > Antimicrobial Peptides > eNAP-2

Antimicrobial Peptides

CAT#
AF3177
Sequence
EVERKHPLGGSRPGRCPTVPPGTFGHCACLCTGDASEPKGQKCCSN
Host Chemicals
Horse
Length
46
Activity
Gram+ & Gram-,
SwissProt ID
SwissProt ID: P56928
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.