CAT# | AF3177 |
Sequence | EVERKHPLGGSRPGRCPTVPPGTFGHCACLCTGDASEPKGQKCCSN |
Activity | Gram+ & Gram-, |
Host Chemicals | Horse | Length | 46 | SwissProt ID | SwissProt ID: P56928 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF666 | Nigroain-B1 | Inquiry | ||
AF806 | Lysozyme | Inquiry | ||
AF2312 | Def-Bbb | Inquiry | ||
AF1749 | Enkelytin | Inquiry | ||
AF1690 | Ranatuerin-2PLd | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Basic Fibroblast Growth Factor, Human, called basic fibroblast growth factor (bFGF/FGF-b/FGF-2), is a single cha ...
P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...