Home > Product > Catalog Peptides > Others > β-Endorphin (bovine, camel, mouse)

Others

β-Endorphin (bovine, camel, mouse)

[Price Inquiry]
CAT#
E05024
Sequence
YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
M.W/Mr.
3438.01
Molecular Formula
C155H250N42O44S
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.