Home > Product > Catalog Peptides > Others > β-Endorphin (bovine, camel, mouse)

Others

β-Endorphin (bovine, camel, mouse)

Price Inquiry
CAT#
E05024
Sequence
YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
M.W/Mr.
3438.01
Molecular Formula
C155H250N42O44S
Length
31

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.