Home > Product > Catalog Peptides > Others > β-Endorphin (equine)

Others

β-Endorphin (equine)

[Price Inquiry]
CAT#
E05022
Sequence
YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
M.W/Mr.
3423.99
Molecular Formula
C154H248N42O44S
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.