Home > Product > Catalog Peptides > Others > β-Endorphin, human

Others

warning All products are for research use only. Not for human use.

β-Endorphin, human

[Price Inquiry]
CAT#
E05025
Sequence
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
M.W/Mr.
3465.1
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.