Home > Product > Catalog Peptides > Others > β-Endorphin, porcine

Others

β-Endorphin, porcine

[Price Inquiry]
CAT#
E05023
Sequence
YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
M.W/Mr.
3424
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.