CAT# | E05026 |
M.W/Mr. | 3466.1 |
Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ |
Length | 31 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
E05032 | [Met5, Lys6] a-Neo-Endorphin (1-6) | Inquiry | ||
E05015 | Acetyl, β-Endorphin (1-26), human | Inquiry | ||
E05023 | β-Endorphin, porcine | Inquiry | ||
E05036 | β-Lipotropin (1-10), porcine | Inquiry | ||
E05037 | [Arg8] a-Neo-Endorphin (1-8) | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Compstatin is a 13-residue cyclic peptide (Ile1-Cys2-Val3-Val4-Gln5-Asp6-Trp7-Gly8-His9-His10-Arg11-Cys12-Thr13- ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...
An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...