Home > Product > Catalog Peptides > Others > β-Endorphin, rat

Others

β-Endorphin, rat

[Price Inquiry]
CAT#
E05026
Sequence
YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ
M.W/Mr.
3466.1
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.