Home > Product > Antimicrobial Peptides > Enteric beta defensin

Antimicrobial Peptides

Enteric beta defensin

[Price Inquiry]
CAT#
AF2518
Sequence
NPQSCHRNKGICVPIRCPGNMRQIGTCLGPPVKCCR
Host Chemicals
Bubalus bubalis
Length
36
Activity
Antimicrobial
SwissProt ID
Q7YS43
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.