Home > Product > Antimicrobial Peptides > Enterocin 7B

Antimicrobial Peptides

Enterocin 7B

Price Inquiry
CAT#
AF3017
Sequence
MGAIAKLVAKFGWPFIKKFYKQIMQFIGQGWTIDQIEKWLKRH
Host Chemicals
Enterococcus faecalis 710C; Enterococcus faecalis MRR 10-3
Length
43
Activity
Gram+,
SwissProt ID
PDB ID: 2m60

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.