CAT# | AF3017 |
Sequence | MGAIAKLVAKFGWPFIKKFYKQIMQFIGQGWTIDQIEKWLKRH |
Activity | Gram+, |
Host Chemicals | Enterococcus faecalis 710C; Enterococcus faecalis MRR 10-3 | Length | 43 | SwissProt ID | PDB ID: 2m60 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3065 | Heliomicin Mutant | Inquiry | ||
AF1383 | Latarcin-4b | Inquiry | ||
AF2245 | Brevinin-2-AJ2 antimicrobial peptide precursor | Inquiry | ||
AF1991 | EC-proHep3 | Inquiry | ||
AF840 | Lunatusin | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...
GLP-1 is a 30 amino acid peptide (molecular weight of 3297.5) secreted by intestinal L-cells in response to meal ingestion wi ...
The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...
P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...