Home > Product > Antimicrobial Peptides > Enterocin 7B

Antimicrobial Peptides

Enterocin 7B

[Price Inquiry]
CAT#
AF3017
Sequence
MGAIAKLVAKFGWPFIKKFYKQIMQFIGQGWTIDQIEKWLKRH
Host Chemicals
Enterococcus faecalis 710C; Enterococcus faecalis MRR 10-3
Length
43
Activity
Gram+,
SwissProt ID
PDB ID: 2m60
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.