Home > Product > Antimicrobial Peptides > Enterocin B

Antimicrobial Peptides

Enterocin B

[Price Inquiry]
CAT#
AF3300
Sequence
ENDHRMPNNLNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKCN
Host Chemicals
Enterococcus faecium T136
Length
53
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.