Home > Product > Antimicrobial Peptides > Enterocin EJ97

Antimicrobial Peptides

Enterocin EJ97

[Price Inquiry]
CAT#
AF3103
Sequence
MLAKIKAMIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA
Host Chemicals
Enterococcus faecalis
Length
44
Activity
Antibacterial
SwissProt ID
Q8KMU4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.