Home > Product > Antimicrobial Peptides > Enterocin L50A

Antimicrobial Peptides

Enterocin L50A

[Price Inquiry]
CAT#
AF3102
Sequence
MGAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIEWIKKHI
Host Chemicals
Enterococcus faecium
Length
44
Activity
Antibacterial
SwissProt ID
Q7B2P3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.