Home > Product > Antimicrobial Peptides > Enterocin L50B

Antimicrobial Peptides

Enterocin L50B

[Price Inquiry]
CAT#
AF3018
Sequence
MGAIAKLVTKFGWPLIKKFYKQIMQFIGQGWTIDQIEKWLKRH
Host Chemicals
Enterococcus faecium
Length
43
Activity
Antibacterial
SwissProt ID
Q7B2P2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.