Home > Product > Antimicrobial Peptides > Enterocin P precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Enterocin P precursor

[Price Inquiry]
CAT#
AF3058
Sequence
ATRSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH
Host Chemicals
Enterococcus faecium
Length
44
Activity
Antibacterial
SwissProt ID
O30434
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.