Home > Product > Antimicrobial Peptides > Enterocin Q

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Enterocin Q

[Price Inquiry]
CAT#
AF2380
Sequence
MNFLKNGIAKWMTGAELQAYKKKYGCLPWEKISC
Host Chemicals
Enterococcus faecium
Length
34
Activity
Antibacterial
SwissProt ID
Q7WYZ9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.