Home > Product > Antimicrobial Peptides > Enterocin RJ-11

Antimicrobial Peptides

Enterocin RJ-11

[Price Inquiry]
CAT#
AF3055
Sequence
APAGLVAKFGRPIVKKYYKQIMQFIGEGSAINKIIPWIARMWRT
Host Chemicals
Enterococcus faecalis RJ-11
Length
44
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.