Keywords Search Google Search Search

Enterocin RJ-11

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3055
Sequence	APAGLVAKFGRPIVKKYYKQIMQFIGEGSAINKIIPWIARMWRT
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF3095	Mutacin IV	Inquiry
AF476	Bb-AMP4	Inquiry
AF3341	BMAP-18	Inquiry
AF1360	Brevinin-1-OR5	Inquiry
AF2021	Ranatuerin-2PRa precursor	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of myristoyl pentapeptide-11 in skin

Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...

Function of R8-T198wt in prostate cancer

The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...

Obtustatin: a potent selective α1β1 inhibitor

Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...

Function of NFAT inhibitor

NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...

GR 64349, A Selective and Potent NK2 Agonist

GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Enterococcus faecalis RJ-11
Length	44