Home > Product > Antimicrobial Peptides > Enterocin SE-K4

Antimicrobial Peptides

Enterocin SE-K4

[Price Inquiry]
CAT#
AF2984
Sequence
ATYYGNGVYCNKQKCWVDWSRARSEIIDRGVKAYVNGFTKVLG
Host Chemicals
Enterococcus faecalis
Length
43
Activity
Antibacterial
SwissProt ID
Q8GR39
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.