Home > Product > Antimicrobial Peptides > Enterocin X

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Enterocin X

[Price Inquiry]
CAT#
AF2798
Sequence
SNDSLWYGVGQEMGKQANCITNHPVKHMIIPGYCSKILG
Host Chemicals
Enterococcus faecium KU-B5
Length
39
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.