Home > Product > Antimicrobial Peptides > Entianin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2169
Sequence
WKSESVCTPGCVTGLLQTCFLQTITCNCKISK
Host Chemicals
Bacillus subtilis DSM 15029T
Length
32
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.