Home > Product > Antimicrobial Peptides > Epicidin 280

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Epicidin 280

[Price Inquiry]
CAT#
AF1973
Sequence
SLGPAIKATRQVCPKATRFVTVSCKKSDCQ
Host Chemicals
Staphylococcus epidermidis
Length
30
Activity
Antibacterial
SwissProt ID
O54220
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.