Home > Product > Antimicrobial Peptides > Epicidin 280

Antimicrobial Peptides

Epicidin 280

Price Inquiry
CAT#
AF1973
Sequence
SLGPAIKATRQVCPKATRFVTVSCKKSDCQ
Host Chemicals
Staphylococcus epidermidis
Length
30
Activity
Antibacterial
SwissProt ID
O54220

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.