CAT# | AF1973 |
Sequence | SLGPAIKATRQVCPKATRFVTVSCKKSDCQ |
Activity | Antibacterial |
Host Chemicals | Staphylococcus epidermidis | Length | 30 | SwissProt ID | O54220 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF022 | Ascalin | Inquiry | ||
AF2085 | Brevinin-2-RA17 peptide precursor | Inquiry | ||
AF028 | Oligoventin | Inquiry | ||
AF624 | Phylloseptin-P1 | Inquiry | ||
AF2941 | Gallerimycin | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
2. Emu oil in combination with other active ingredients for treating skin imperfections
3. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
5. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...
Delcasertib, also known as KAI-9803, is a 23-amino acid peptide and δ-protein kinase C (δ-PKC) inhibitor. KAI-9 ...
An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
The hexapeptide-9, a cosmetic peptide of skin agingSkin aging is the obvious external manifestation of a natural ...