Home > Product > Antimicrobial Peptides > Ericin S

Antimicrobial Peptides

CAT#
AF2170
Sequence
WKSESVCTPGCVTGVLQTCFLQTITCNCHISK
Host Chemicals
Bacillus subtilis A1/3
Length
32
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.