Home > Product > Antimicrobial Peptides > Esculentin-1V-HN1 antimicrobial peptide precursor

Antimicrobial Peptides

Esculentin-1V-HN1 antimicrobial peptide precursor

Price Inquiry
CAT#
AF3174
Sequence
TMKKPLLLIVLLGIISLSLCEQERAADEDEGSEIKRGIFSKFAGK
Host Chemicals
Odorrana hainanensis
Length
45
Activity
Antimicrobial
SwissProt ID
E7EKC6

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.