Home > Product > Antimicrobial Peptides > Esculentin-1V-HN1 antimicrobial peptide precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Esculentin-1V-HN1 antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF3174
Sequence
TMKKPLLLIVLLGIISLSLCEQERAADEDEGSEIKRGIFSKFAGK
Host Chemicals
Odorrana hainanensis
Length
45
Activity
Antimicrobial
SwissProt ID
E7EKC6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.