Home > Product > Antimicrobial Peptides > Esculentin-2HSa

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Esculentin-2HSa

[Price Inquiry]
CAT#
AF2592
Sequence
GIFSLIKGAAQLIGKTVAKEAGKTGLELMACKVTKQC
Host Chemicals
Rana hosii
Length
37
Activity
Antibacterial
SwissProt ID
P0C8T9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.