Home > Product > Antimicrobial Peptides > Esculentin-2HSa

Antimicrobial Peptides

Esculentin-2HSa

Price Inquiry
CAT#
AF2592
Sequence
GIFSLIKGAAQLIGKTVAKEAGKTGLELMACKVTKQC
Host Chemicals
Rana hosii
Length
37
Activity
Antibacterial
SwissProt ID
P0C8T9

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.