CAT# | AF2590 |
Sequence | GIFSLIKGAAKLITKTVAKEAGKTGLELMACKVTNQC |
Activity | Antibacterial, Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The hexapeptide-9, a cosmetic peptide of skin agingSkin aging is the obvious external manifestation of a natural ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...