Home > Product > Antimicrobial Peptides > Esculentin-2ISa

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Esculentin-2ISa

[Price Inquiry]
CAT#
AF2590
Sequence
GIFSLIKGAAKLITKTVAKEAGKTGLELMACKVTNQC
Host Chemicals
Odorrana ishikawae
Length
37
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.