Home > Product > Antimicrobial Peptides > Esculentin-2JDb

Antimicrobial Peptides

Esculentin-2JDb

[Price Inquiry]
CAT#
AF2599
Sequence
GIFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC
Host Chemicals
Odorrana jingdongensis
Length
37
Activity
Antibacterial
SwissProt ID
B3A0M9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.