Home > Product > Antimicrobial Peptides > Esculentin-2LTb-SN1 antimicrobial peptide precursor

Antimicrobial Peptides

Esculentin-2LTb-SN1 antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF2394
Sequence
TMKKSLLFFFFLGTISLSLCEQERGADEDDGVEE
Host Chemicals
Hylarana spinulosa
Length
34
Activity
Antimicrobial
SwissProt ID
E7EKH9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.