Home > Product > Antimicrobial Peptides > Esculentin-2P protein

Antimicrobial Peptides

Esculentin-2P protein

[Price Inquiry]
CAT#
AF2591
Sequence
GIFSLIKGAAKVVAKGLGKEVGKFGLDLMACKVTNQC
Host Chemicals
Rana fukienensis
Length
37
Activity
Antimicrobial
SwissProt ID
Q1MU22
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.