Home > Product > Antimicrobial Peptides > Esculentin-2PRa

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Esculentin-2PRa

[Price Inquiry]
CAT#
AF2632
Sequence
GVFSFLKTGAKLLGSTLLKMAGKAGAEHLACKATNQC
Host Chemicals
Rana pretiosa
Length
37
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.