Home > Product > Antimicrobial Peptides > Esculentin-2PRb

Antimicrobial Peptides

Esculentin-2PRb

[Price Inquiry]
CAT#
AF2586
Sequence
GIFSALAAGVKLLGNTLFKMAGKAGAEHLACKATNQC
Host Chemicals
Rana pretiosa
Length
37
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.