Home > Product > Antimicrobial Peptides > Esculentin-2Rb

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Esculentin-2Rb

[Price Inquiry]
CAT#
AF2597
Sequence
GIFSLVKGVAKLAGKTLAKEGGKFGLELAMCKIAKQC
Host Chemicals
Rana ridibunda
Length
37
Activity
Antimicrobial
SwissProt ID
P86021
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.