Home > Product > Antimicrobial Peptides > Esculentin-2V-HN1 antimicrobial peptide precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Esculentin-2V-HN1 antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF2504
Sequence
IFTLFKGAAKLLGKTLAKEAGKTGLELMACKVTNQC
Host Chemicals
Odorrana hainanensis
Length
36
Activity
Antimicrobial
SwissProt ID
E7EKC7
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.