Home > Product > Antimicrobial Peptides > Esculentin-2-OR3

Antimicrobial Peptides

Esculentin-2-OR3

[Price Inquiry]
CAT#
AF2637
Sequence
GVFTLLKGATQLIGKTLGKELGKTGLELMACKITNQC
Host Chemicals
Odorrana rotodora
Length
37
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.