Home > Product > Antimicrobial Peptides > Esculentin-2-OR4

Antimicrobial Peptides

Esculentin-2-OR4

[Price Inquiry]
CAT#
AF2634
Sequence
GVFTLIKGATQLIGKTLGKELGKTGLELMACKITEQC
Host Chemicals
Odorrana rotodora
Length
37
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.