CAT# | AF2505 |
Sequence | IFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...
AdTx1, also called as ρ-Da1a, is a polypeptide of 65 amino acids stabilized by four disulfide bonds, which has a ...
(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...
ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...