Home > Product > Antimicrobial Peptides > Esculentin-2-RA2 peptide precursor

Antimicrobial Peptides

Esculentin-2-RA2 peptide precursor

[Price Inquiry]
CAT#
AF2505
Sequence
IFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC
Host Chemicals
Odorrana andersonii (golden crossband frog)
Length
36
Activity
Antimicrobial
SwissProt ID
E3SYM6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.